PDB-code
| More entries for 2G1T | |||
| 2G1T | Chain: | A | |
| 2G1T | Chain: | B | |
| 2G1T | Chain: | C | |
| Structural information | |
| DFG conformation: | in |
| αC-helix conformation: | out |
| G-rich loop angle (distance): | 50.5° (14.8Å) |
| G-rich loop rotation: | 51.9° |
| Quality Score: | 8 |
| Resolution: | 1.8 Å |
| Missing Residues: | 0 |
| Missing Atoms: | 0 |
| Ligand binding mode | ||||
| Waters | ||||
| Cluster I3 I4 I5 I6 | Ligand No No No No | Protein Yes Yes Yes Yes | ||
| Pocket alignment | |
| Uniprot sequence: | HKLGGGQYGEVYEVAVKTLEFLKEAAVMKEIKPNLVQLLGVYIITEFMTYGNLLDYLREYLEKKNFIHRDLAARNCLVVADFGLS |
| Sequence structure: | HKLGGGQYGEVYEVAVKTLEFLKEAAVMKEIKPNLVQLLGVYIITEFMTYGNLLDYLREYLEKKNFIHRDLAARNCLVVADFGLS |




