ABL proto-oncogene 1, non-receptor tyrosine kinase
Kinase structure
Kinase:ABL1
Family:Abl
Group:TK
Species:HUMAN
IUPHAR/BPS ID:1923
PDB:2HZI
sc-PDB:
KIDFamMap:Search
Release date:2007-01-16
PubMed: 17164530
Chain:A
(Alternate) Model:A
Orthosteric ligand:JIN
2D structure of the orthosteric ligand
Click to open a 3D viewer
The orthosteric binding pocket


More entries for 2HZI
2HZIAlternative model: AChain: B
2HZIAlternative model: BChain: A
2HZIAlternative model: BChain: B


Structural information
DFG conformation:out-like
αC-helix conformation:in
G-rich loop angle (distance):54.6° (16.6Å)
G-rich loop rotation:5.3°
Quality Score:9.7
Resolution:1.7 Å
Missing Residues:0
Missing Atoms:3
Ligand binding mode
PocketsSubpocketsWaters
front
gate
back
BP-I-A
BP-I-B
Cluster
I1
I10
Ligand
No
Yes
Protein
Yes
Yes

Pocket alignment
Uniprot sequence:HKLGGGQYGEVYEVAVKTLEFLKEAAVMKEIKPNLVQLLGVYIITEFMTYGNLLDYLREYLEKKNFIHRDLAARNCLVVADFGLS
Sequence structure:HKLGGGQYGEVYEVAVKTLEFLKEAAVMKEIKPNLVQLLGVYIITEFMTYGNLLDYLREYLEKKNFIHRDLAARNCLVVADFGLS

Ligand affinity
ChEMBL ID:CHEMBL574058
Bioaffinities: 7 records for 4 kinases
Species Kinase (ChEMBL naming) Median Min Max Type Records
Homo sapiensEpidermal growth factor receptor erbB16.46.46.4pIC501
Homo sapiensFibroblast growth factor receptor 1666pIC501
Homo sapiensTyrosine- and threonine-specific cdc2-inhibitory kinase5.65.67pIC502
Homo sapiensTyrosine- and threonine-specific cdc2-inhibitory kinase4.94.98pKi2
Homo sapiensTyrosine-protein kinase SRC7.87.87.8pIC501


Kinase-ligand interaction pattern
Hydrophobic Aromatic face-to-face Aromatic face-to-edge H-bond donor H-bond acceptor Ionic positive Ionic negative
I g.l II III αC
1 H
246
2 K
247
3 L
248
4 G
249
5 G
250
6 G
251
7 Q
252
8 Y
253
9 G
254
10 E
255
11 V
256
12 Y
257
13 E
258
14 V
268
15 A
269
16 V
270
17 K
271
18 T
272
19 L
273
20 E
282
αC b.l IV
21 F
283
22 L
284
23 K
285
24 E
286
25 A
287
26 A
288
27 V
289
28 M
290
29 K
291
30 E
292
31 I
293
32 K
294
33 P
296
34 N
297
35 L
298
36 V
299
37 Q
300
38 L
301
39 L
302
40 G
303
IV V GK hinge linker αD αE
41 V
304
42 Y
312
43 I
313
44 I
314
45 T
315
46 E
316
47 F
317
48 M
318
49 T
319
50 Y
320
51 G
321
52 N
322
53 L
323
54 L
324
55 D
325
56 Y
326
57 L
327
58 R
328
59 E
329
60 Y
353
αE VI c.l VII VIII x
61 L
354
62 E
355
63 K
356
64 K
357
65 N
358
66 F
359
67 I
360
68 H
361
69 R
362
70 D
363
71 L
364
72 A
365
73 A
366
74 R
367
75 N
368
76 C
369
77 L
370
78 V
371
79 V
379
80 A
380
DFG a.l
81 D
381
82 F
382
83 G
383
84 L
384
85 S
385

Interaction pattern search
Search KLIFS for kinase-ligand complexes with similar interaction patterns:
Specify the minimum similarity (0.00 no similarity, 1.00 identical)