ABL proto-oncogene 1, non-receptor tyrosine kinase
Kinase structure
Kinase:ABL1
Family:Abl
Group:TK
Species:HUMAN
IUPHAR/BPS ID:1923
PDB:8SSN
sc-PDB:
KIDFamMap:Search
Release date:2023-09-06
PubMed: 37590418
Chain:A
Orthosteric ligand:SKI
2D structure of the orthosteric ligand
Click to open a 3D viewer
The orthosteric binding pocket
Structural information
DFG conformation:in
αC-helix conformation:out
G-rich loop angle (distance):-
G-rich loop rotation:-
Quality Score:6.8
Resolution:2.86 Å
Missing Residues:3
Missing Atoms:0
Ligand binding mode
PocketsSubpockets
front
gate
BP-I-B
BP-II-in

Allosteric Ligand
Allosteric ligand:AY7
2D structure of the allostericligand
Pocket alignment
Uniprot sequence:HKLGGGQYGEVYEVAVKTLEFLKEAAVMKEIKPNLVQLLGVYIITEFMTYGNLLDYLREYLEKKNFIHRDLAARNCLVVADFGLS
Sequence structure:HKLGGG___EVYEVAVKTLEFLKEAAVMKEIKPNLVQLLGVYIITEFMTYGNLLDYLREYLEKKNFIHRDLAARNCLVVADFGLS

Ligand affinity
ChEMBL ID:CHEMBL97771
Bioaffinities: 4 records for 3 kinases
Species Kinase (ChEMBL naming) Median Min Max Type Records
Homo sapiensEphrin type-B receptor 24.14.14.1pIC501
Homo sapiensEphrin type-B receptor 24.24.24.2pKd1
Homo sapiensSerine/threonine-protein kinase RIPK27.67.67.6pIC501
Gallus gallusTyrosine-protein kinase SRC6.86.86.8pIC501


Kinase-ligand interaction pattern
Hydrophobic Aromatic face-to-face Aromatic face-to-edge H-bond donor H-bond acceptor Ionic positive Ionic negative
I g.l II III αC
1 H
265
2 K
266
3 L
267
4 G
268
5 G
269
6 G
270
7 _
_
8 _
_
9 _
_
10 E
274
11 V
275
12 Y
276
13 E
277
14 V
287
15 A
288
16 V
289
17 K
290
18 T
291
19 L
292
20 E
301
αC b.l IV
21 F
302
22 L
303
23 K
304
24 E
305
25 A
306
26 A
307
27 V
308
28 M
309
29 K
310
30 E
311
31 I
312
32 K
313
33 P
315
34 N
316
35 L
317
36 V
318
37 Q
319
38 L
320
39 L
321
40 G
322
IV V GK hinge linker αD αE
41 V
323
42 Y
331
43 I
332
44 I
333
45 T
334
46 E
335
47 F
336
48 M
337
49 T
338
50 Y
339
51 G
340
52 N
341
53 L
342
54 L
343
55 D
344
56 Y
345
57 L
346
58 R
347
59 E
348
60 Y
372
αE VI c.l VII VIII x
61 L
373
62 E
374
63 K
375
64 K
376
65 N
377
66 F
378
67 I
379
68 H
380
69 R
381
70 D
382
71 L
383
72 A
384
73 A
385
74 R
386
75 N
387
76 C
388
77 L
389
78 V
390
79 V
398
80 A
399
DFG a.l
81 D
400
82 F
401
83 G
402
84 L
403
85 S
404

Interaction pattern search
Search KLIFS for kinase-ligand complexes with similar interaction patterns:
Specify the minimum similarity (0.00 no similarity, 1.00 identical)